SCAP2 MaxPab mouse polyclonal antibody (B01) View larger

SCAP2 MaxPab mouse polyclonal antibody (B01)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCAP2 MaxPab mouse polyclonal antibody (B01)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ti,WB-Tr

More info about SCAP2 MaxPab mouse polyclonal antibody (B01)

Brand: Abnova
Reference: H00008935-B01
Product name: SCAP2 MaxPab mouse polyclonal antibody (B01)
Product description: Mouse polyclonal antibody raised against a full-length human SCAP2 protein.
Gene id: 8935
Gene name: SKAP2
Gene alias: MGC10411|MGC33304|PRAP|RA70|SAPS|SCAP2|SKAP-HOM|SKAP55R
Gene description: src kinase associated phosphoprotein 2
Genbank accession: BC036044
Immunogen: SCAP2 (AAH36044, 1 a.a. ~ 359 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI
Protein accession: AAH36044
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008935-B01-13-15-1.jpg
Application image note: Western Blot analysis of SKAP2 expression in transfected 293T cell line (H00008935-T01) by SKAP2 MaxPab polyclonal antibody.

Lane1:SCAP2 transfected lysate(39.6 KDa).
Lane 2:Non-transfected lysate.
Applications: WB-Ti,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy SCAP2 MaxPab mouse polyclonal antibody (B01) now

Add to cart