Brand: | Abnova |
Reference: | H00008934-M03 |
Product name: | RAB7L1 monoclonal antibody (M03), clone 2B8 |
Product description: | Mouse monoclonal antibody raised against a full length recombinant RAB7L1. |
Clone: | 2B8 |
Isotype: | IgG2b Kappa |
Gene id: | 8934 |
Gene name: | RAB7L1 |
Gene alias: | DKFZp686P1051|RAB7L |
Gene description: | RAB7, member RAS oncogene family-like 1 |
Genbank accession: | BC002585 |
Immunogen: | RAB7L1 (AAH02585, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC |
Protein accession: | AAH02585 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (48.07 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | RAB7L1 monoclonal antibody (M03), clone 2B8 Western Blot analysis of RAB7L1 expression in Jurkat ( Cat # L017V1 ). |
Applications: | WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab |
Shipping condition: | Dry Ice |