RAB7L1 monoclonal antibody (M02), clone 1B10 View larger

RAB7L1 monoclonal antibody (M02), clone 1B10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of RAB7L1 monoclonal antibody (M02), clone 1B10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about RAB7L1 monoclonal antibody (M02), clone 1B10

Brand: Abnova
Reference: H00008934-M02
Product name: RAB7L1 monoclonal antibody (M02), clone 1B10
Product description: Mouse monoclonal antibody raised against a full-length recombinant RAB7L1.
Clone: 1B10
Isotype: IgG2b Kappa
Gene id: 8934
Gene name: RAB7L1
Gene alias: DKFZp686P1051|RAB7L
Gene description: RAB7, member RAS oncogene family-like 1
Genbank accession: BC002585
Immunogen: RAB7L1 (AAH02585, 1 a.a. ~ 203 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MGSRDHLFKVLVVGDAAVGKTSLVQRYSQDSFSKHYKSTVGVDFALKVLQWSDYEIVRLQLWDIAGQERFTSMTRLYYRDASACVIMFDVTNATTFSNSQRWKQDLDSKLTLPNGEPVPCLLLANKCDLSPWAVSRDQIDRFSKENGFTGWTETSVKENKNINEAMRVLIEKMMRNSTEDIMSLSTQGDYINLQTKSSSWSCC
Protein accession: AAH02585
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008934-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (48.07 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008934-M02-1-6-1.jpg
Application image note: RAB7L1 monoclonal antibody (M02), clone 1B10. Western Blot analysis of RAB7L1 expression in Jurkat(Cat # L017V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy RAB7L1 monoclonal antibody (M02), clone 1B10 now

Add to cart