CACNA1I monoclonal antibody (M02), clone 3H5 View larger

CACNA1I monoclonal antibody (M02), clone 3H5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CACNA1I monoclonal antibody (M02), clone 3H5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about CACNA1I monoclonal antibody (M02), clone 3H5

Brand: Abnova
Reference: H00008911-M02
Product name: CACNA1I monoclonal antibody (M02), clone 3H5
Product description: Mouse monoclonal antibody raised against a partial recombinant CACNA1I.
Clone: 3H5
Isotype: IgG1 Kappa
Gene id: 8911
Gene name: CACNA1I
Gene alias: Cav3.3|KIAA1120
Gene description: calcium channel, voltage-dependent, T type, alpha 1I subunit
Genbank accession: NM_021096
Immunogen: CACNA1I (NP_066919, 233 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA
Protein accession: NP_066919
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008911-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008911-M02-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged CACNA1I is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CACNA1I monoclonal antibody (M02), clone 3H5 now

Add to cart