Brand: | Abnova |
Reference: | H00008911-M02 |
Product name: | CACNA1I monoclonal antibody (M02), clone 3H5 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CACNA1I. |
Clone: | 3H5 |
Isotype: | IgG1 Kappa |
Gene id: | 8911 |
Gene name: | CACNA1I |
Gene alias: | Cav3.3|KIAA1120 |
Gene description: | calcium channel, voltage-dependent, T type, alpha 1I subunit |
Genbank accession: | NM_021096 |
Immunogen: | CACNA1I (NP_066919, 233 a.a. ~ 331 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | GLLRNRCFLEENFTIQGDVALPPYYQPEEDDEMPFICSLSGDNGIMGCHEIPPLKEQGRECCLSKDDVYDFGAGRQDLNASGLCVNWNRYYNVCRTGSA |
Protein accession: | NP_066919 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged CACNA1I is approximately 0.3ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |