P11 monoclonal antibody (M01), clone 2H1 View larger

P11 monoclonal antibody (M01), clone 2H1

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of P11 monoclonal antibody (M01), clone 2H1

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about P11 monoclonal antibody (M01), clone 2H1

Brand: Abnova
Reference: H00008909-M01
Product name: P11 monoclonal antibody (M01), clone 2H1
Product description: Mouse monoclonal antibody raised against a partial recombinant P11.
Clone: 2H1
Isotype: IgG2a Kappa
Gene id: 8909
Gene name: P11
Gene alias: MGC133268|PP11|PRSS26
Gene description: 26 serine protease
Genbank accession: NM_006025
Immunogen: P11 (NP_006016.1, 270 a.a. ~ 369 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EGLVDYYSHIYDGPWDSYPDVLAMQFNWDGYYKEVGSAFIGSSPEFEFALYSLCFIARPGKVCQLSLGGYPLAVRTYTWDKSTYGNGKKYIATAYIVSST
Protein accession: NP_006016.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008909-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008909-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged P11 is 1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy P11 monoclonal antibody (M01), clone 2H1 now

Add to cart