AP1S2 monoclonal antibody (M01), clone 3B9-G5 View larger

AP1S2 monoclonal antibody (M01), clone 3B9-G5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AP1S2 monoclonal antibody (M01), clone 3B9-G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA

More info about AP1S2 monoclonal antibody (M01), clone 3B9-G5

Brand: Abnova
Reference: H00008905-M01
Product name: AP1S2 monoclonal antibody (M01), clone 3B9-G5
Product description: Mouse monoclonal antibody raised against a full length recombinant AP1S2.
Clone: 3B9-G5
Isotype: IgG2b kappa
Gene id: 8905
Gene name: AP1S2
Gene alias: DC22|MGC:1902|MRX59|SIGMA1B
Gene description: adaptor-related protein complex 1, sigma 2 subunit
Genbank accession: BC001117
Immunogen: AP1S2 (AAH01117, 1 a.a. ~ 157 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MQFMLLFSRQGKLRLQKWYVPLSDKEKKKITRELVQTVLARKPKMCSFLEWRDLKIVYKRYASLYFCCAIEDQDNELITLEIIHRYVELLDKYFGSVCELDIIFNFEKAYFILDEFLLGGEVQETSKKNVLKAIEQADLLQEEAETPRSVLEEIGLT
Protein accession: AAH01117
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008905-M01-9-18-1.jpg
Application image note: Detection limit for recombinant GST tagged AP1S2 is approximately 3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy AP1S2 monoclonal antibody (M01), clone 3B9-G5 now

Add to cart