CPNE1 monoclonal antibody (M01), clone 8B8 View larger

CPNE1 monoclonal antibody (M01), clone 8B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPNE1 monoclonal antibody (M01), clone 8B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab

More info about CPNE1 monoclonal antibody (M01), clone 8B8

Brand: Abnova
Reference: H00008904-M01
Product name: CPNE1 monoclonal antibody (M01), clone 8B8
Product description: Mouse monoclonal antibody raised against a partial recombinant CPNE1.
Clone: 8B8
Isotype: IgG2a Kappa
Gene id: 8904
Gene name: CPNE1
Gene alias: COPN1|CPN1|MGC1142
Gene description: copine I
Genbank accession: NM_003915
Immunogen: CPNE1 (NP_003906, 111 a.a. ~ 210 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLPLMLKPGKPAGRGTITVSAQELKDNRVVTMEVEARNLDKKDFLGKSDPFLEFFRQGDGKWHLVYRSEVIKNNLNPTWKRFSVPVQHFCGGNPSTPIQV
Protein accession: NP_003906
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008904-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008904-M01-1-1-1.jpg
Application image note: CPNE1 monoclonal antibody (M01), clone 8B8 Western Blot analysis of CPNE1 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr,RNAi-Ab
Shipping condition: Dry Ice

Reviews

Buy CPNE1 monoclonal antibody (M01), clone 8B8 now

Add to cart