CCNA1 monoclonal antibody (M02), clone 4A11-5B5 View larger

CCNA1 monoclonal antibody (M02), clone 4A11-5B5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CCNA1 monoclonal antibody (M02), clone 4A11-5B5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re,PLA-Ce

More info about CCNA1 monoclonal antibody (M02), clone 4A11-5B5

Brand: Abnova
Reference: H00008900-M02
Product name: CCNA1 monoclonal antibody (M02), clone 4A11-5B5
Product description: Mouse monoclonal antibody raised against a full length recombinant CCNA1.
Clone: 4A11-5B5
Isotype: IgG1 Kappa
Gene id: 8900
Gene name: CCNA1
Gene alias: -
Gene description: cyclin A1
Genbank accession: BC036346
Immunogen: CCNA1 (AAH36346, 1 a.a. ~ 464 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: METGFPAIMYPGSFIGGWGEEYLSWEGPGLPDFVFQQPVESEAMHCSNPKSGVVLATVARGPDACQILTRAPLGQDPPQRTVLGLLTANGQYRRTCGQGITRIRCYSGSENAFPPAGKKALPDCGVQEPPKQGFDIYMDELEQGDRDSCSVREGMAFEDVYEVDTGTLKSDLHFLLDFNTVSPMLVDSSLLSQSEDISSLGTDVINVTEYAEEIYQYLREAEIRHRPKAHYMKKQPDITEGMRTILVDWLVEVGEEYKLRAETLYLAVNFLDRFLSCMSVLRGKLQLVGTAAMLLASKYEEIYPPEVDEFVYITDDTYTKRQLLKMEHLLLKVLAFDLTVPTTNQFLLQYLRRQGVCVRTENLAKYVAELSLLEADPFLKYLPSLIAAAAFCLANYTVNKHFWPETLAAFTGYSLSEIVPCLSELHKAYLDIPHRPQQAIREKYKASKYLCVSLMEPPAVLLLQ
Protein accession: AAH36346
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008900-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (76.78 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008900-M02-57-1-1.jpg
Application image note: Proximity Ligation Analysis of protein-protein interactions between PTK2 and CCNA1. HeLa cells were stained with anti-PTK2 rabbit purified polyclonal 1:1200 and anti-CCNA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Applications: S-ELISA,ELISA,WB-Re,PLA-Ce
Shipping condition: Dry Ice

Reviews

Buy CCNA1 monoclonal antibody (M02), clone 4A11-5B5 now

Add to cart