PRPF4B monoclonal antibody (M01), clone 3E10 View larger

PRPF4B monoclonal antibody (M01), clone 3E10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PRPF4B monoclonal antibody (M01), clone 3E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re

More info about PRPF4B monoclonal antibody (M01), clone 3E10

Brand: Abnova
Reference: H00008899-M01
Product name: PRPF4B monoclonal antibody (M01), clone 3E10
Product description: Mouse monoclonal antibody raised against a partial recombinant PRPF4B.
Clone: 3E10
Isotype: IgG2a Kappa
Gene id: 8899
Gene name: PRPF4B
Gene alias: KIAA0536|PR4H|PRP4|PRP4H|PRP4K|dJ1013A10.1
Gene description: PRP4 pre-mRNA processing factor 4 homolog B (yeast)
Genbank accession: NM_003913
Immunogen: PRPF4B (NP_003904.2, 898 a.a. ~ 1005 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: LKLAMDLKGKMPNKMIRKGVFKDQHFDQNLNFMYIEVDKVTEREKVTVMSTINPTKDLLADLIGCQRLPEDQRKKVHQLKDLLDQILMLDPAKRISINQALQHAFIQE
Protein accession: NP_003904.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008899-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.62 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008899-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged PRPF4B is 1 ng/ml as a capture antibody.
Applications: IF,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Loss of cyclin-dependent kinase-like 2 predicts poor prognosis in gastric cancer, and its overexpression suppresses cells growth and invasion.Fang CL, Uen YH, Chen HK, Hseu YC, Lin CC, Hung ST, Sun DP, Lin KY.
Cancer Med. 2018 May 23. [Epub ahead of print]

Reviews

Buy PRPF4B monoclonal antibody (M01), clone 3E10 now

Add to cart