MTMR3 monoclonal antibody (M07), clone 1E11 View larger

MTMR3 monoclonal antibody (M07), clone 1E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MTMR3 monoclonal antibody (M07), clone 1E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about MTMR3 monoclonal antibody (M07), clone 1E11

Brand: Abnova
Reference: H00008897-M07
Product name: MTMR3 monoclonal antibody (M07), clone 1E11
Product description: Mouse monoclonal antibody raised against a partial recombinant MTMR3.
Clone: 1E11
Isotype: IgG2a Kappa
Gene id: 8897
Gene name: MTMR3
Gene alias: FLJ32333|FYVE-DSP1|KIAA0371|ZFYVE10
Gene description: myotubularin related protein 3
Genbank accession: NM_021090
Immunogen: MTMR3 (NP_066576.1, 579 a.a. ~ 674 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CPSPTTPVDDSCAPYPAPGTSPDDPPLSRLPKTRSYDNLTTACDNTVPLASRRCSDPSLNEKWQEHRRSLELSSLAGPGEDPLSADSLGKPTRVPG
Protein accession: NP_066576.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008897-M07-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008897-M07-13-15-1.jpg
Application image note: Western Blot analysis of MTMR3 expression in transfected 293T cell line by MTMR3 monoclonal antibody (M07), clone 1E11.

Lane 1: MTMR3 transfected lysate(133.6 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy MTMR3 monoclonal antibody (M07), clone 1E11 now

Add to cart