G10 monoclonal antibody (M10), clone 1E10 View larger

G10 monoclonal antibody (M10), clone 1E10

H00008896-M10_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of G10 monoclonal antibody (M10), clone 1E10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about G10 monoclonal antibody (M10), clone 1E10

Brand: Abnova
Reference: H00008896-M10
Product name: G10 monoclonal antibody (M10), clone 1E10
Product description: Mouse monoclonal antibody raised against a partial recombinant G10.
Clone: 1E10
Isotype: IgG2b Kappa
Gene id: 8896
Gene name: BUD31
Gene alias: EDG-2|EDG2|G10|MGC111202|YCR063W|fSAP17
Gene description: BUD31 homolog (S. cerevisiae)
Genbank accession: NM_003910
Immunogen: G10 (NP_003901, 35 a.a. ~ 144 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Protein accession: NP_003901
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008896-M10-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.73 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008896-M10-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged G10 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy G10 monoclonal antibody (M10), clone 1E10 now

Add to cart