G10 MaxPab mouse polyclonal antibody (B02) View larger

G10 MaxPab mouse polyclonal antibody (B02)

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of G10 MaxPab mouse polyclonal antibody (B02)

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,WB-Tr

More info about G10 MaxPab mouse polyclonal antibody (B02)

Brand: Abnova
Reference: H00008896-B02
Product name: G10 MaxPab mouse polyclonal antibody (B02)
Product description: Mouse polyclonal antibody raised against a full-length human G10 protein.
Gene id: 8896
Gene name: BUD31
Gene alias: EDG-2|EDG2|G10|MGC111202|YCR063W|fSAP17
Gene description: BUD31 homolog (S. cerevisiae)
Genbank accession: NM_003910.2
Immunogen: G10 (NP_003901.2, 1 a.a. ~ 144 a.a) full-length human protein.
Immunogen sequence/protein sequence: MPKVKRSRKAPPDGWELIEPTLDELDQKMREAETEPHEGKRKVESLWPIFRIHHQKTRYIFDLFYKRKAISRELYEYCIKEGYADKNLIAKWKKQGYENLCCLRCIQTRDTNFGTNCICRVPKSKLEVGRIIECTHCGCRGCSG
Protein accession: NP_003901.2
Storage buffer: No additive
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody reactive against mammalian transfected lysate.
Note: For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008896-B02-13-15-1.jpg
Application image note: Western Blot analysis of BUD31 expression in transfected 293T cell line (H00008896-T02) by BUD31 MaxPab polyclonal antibody.

Lane 1: G10 transfected lysate(15.84 KDa).
Lane 2: Non-transfected lysate.
Applications: IF,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy G10 MaxPab mouse polyclonal antibody (B02) now

Add to cart