CPNE3 monoclonal antibody (M02), clone 4F4 View larger

CPNE3 monoclonal antibody (M02), clone 4F4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of CPNE3 monoclonal antibody (M02), clone 4F4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re

More info about CPNE3 monoclonal antibody (M02), clone 4F4

Brand: Abnova
Reference: H00008895-M02
Product name: CPNE3 monoclonal antibody (M02), clone 4F4
Product description: Mouse monoclonal antibody raised against a partial recombinant CPNE3.
Clone: 4F4
Isotype: IgG2a Kappa
Gene id: 8895
Gene name: CPNE3
Gene alias: CPN3|KIAA0636|PRO1071
Gene description: copine III
Genbank accession: NM_003909
Immunogen: CPNE3 (NP_003900.1, 164 a.a. ~ 244 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EFHKQTSDGNWLMVHRTEVVKNNLNPVWRPFKISLNSLCYGDMDKTIKVECYDYDNDGSHDLIGTFQTTMTKLKEASRSSP
Protein accession: NP_003900.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008895-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (34.65 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008895-M02-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged CPNE3 is 0.1 ng/ml as a capture antibody.
Applications: WB-Ce,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy CPNE3 monoclonal antibody (M02), clone 4F4 now

Add to cart