EIF2S2 monoclonal antibody (M09), clone 2F3 View larger

EIF2S2 monoclonal antibody (M09), clone 2F3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of EIF2S2 monoclonal antibody (M09), clone 2F3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr

More info about EIF2S2 monoclonal antibody (M09), clone 2F3

Brand: Abnova
Reference: H00008894-M09
Product name: EIF2S2 monoclonal antibody (M09), clone 2F3
Product description: Mouse monoclonal antibody raised against a partial recombinant EIF2S2.
Clone: 2F3
Isotype: IgG1 Kappa
Gene id: 8894
Gene name: EIF2S2
Gene alias: DKFZp686L18198|EIF2|EIF2B|EIF2beta|MGC8508
Gene description: eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa
Genbank accession: NM_003908
Immunogen: EIF2S2 (NP_003899.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD
Protein accession: NP_003899.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008894-M09-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00008894-M09-1-1-1.jpg
Application image note: EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in HeLa ( Cat # L013V1 ).
Applications: WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy EIF2S2 monoclonal antibody (M09), clone 2F3 now

Add to cart