Brand: | Abnova |
Reference: | H00008894-M09 |
Product name: | EIF2S2 monoclonal antibody (M09), clone 2F3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant EIF2S2. |
Clone: | 2F3 |
Isotype: | IgG1 Kappa |
Gene id: | 8894 |
Gene name: | EIF2S2 |
Gene alias: | DKFZp686L18198|EIF2|EIF2B|EIF2beta|MGC8508 |
Gene description: | eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa |
Genbank accession: | NM_003908 |
Immunogen: | EIF2S2 (NP_003899.2, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKD |
Protein accession: | NP_003899.2 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human,Mouse,Rat |
Application image: |  |
Application image note: | EIF2S2 monoclonal antibody (M09), clone 2F3. Western Blot analysis of EIF2S2 expression in HeLa ( Cat # L013V1 ). |
Applications: | WB-Ce,IHC-P,IF,S-ELISA,ELISA,WB-Re,WB-Tr |
Shipping condition: | Dry Ice |