Brand: | Abnova |
Reference: | H00008893-A01 |
Product name: | EIF2B5 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant EIF2B5. |
Gene id: | 8893 |
Gene name: | EIF2B5 |
Gene alias: | CACH|CLE|EIF-2B|EIF2Bepsilon|LVWM |
Gene description: | eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa |
Genbank accession: | NM_003907 |
Immunogen: | EIF2B5 (NP_003898, 622 a.a. ~ 720 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | LPLLKAWSPVFRNYIKRAADHLEALAAIEDFFLEHEALGISMAKVLMAFYQLEILAEETILSWFSQRDTTDKGQQLRKNQQLQRFIQWLKEAEEESSED |
Protein accession: | NP_003898 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | EIF2B5 polyclonal antibody (A01), Lot # 060814QCS1 Western Blot analysis of EIF2B5 expression in 293 ( Cat # L026V1 ). |
Applications: | WB-Ce,WB-Ti,ELISA,WB-Re |
Shipping condition: | Dry Ice |