MCM3AP monoclonal antibody (M01), clone 1H3 View larger

MCM3AP monoclonal antibody (M01), clone 1H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of MCM3AP monoclonal antibody (M01), clone 1H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,S-ELISA,ELISA

More info about MCM3AP monoclonal antibody (M01), clone 1H3

Brand: Abnova
Reference: H00008888-M01
Product name: MCM3AP monoclonal antibody (M01), clone 1H3
Product description: Mouse monoclonal antibody raised against a partial recombinant MCM3AP.
Clone: 1H3
Isotype: IgG2a Kappa
Gene id: 8888
Gene name: MCM3AP
Gene alias: FLJ44336|FLJ45306|GANP|KIAA0572|MAP80
Gene description: minichromosome maintenance complex component 3 associated protein
Genbank accession: BC013285
Immunogen: MCM3AP (AAH13285, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA
Protein accession: AAH13285
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008888-M01-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to MCM3AP on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,S-ELISA,ELISA
Shipping condition: Dry Ice

Reviews

Buy MCM3AP monoclonal antibody (M01), clone 1H3 now

Add to cart