Brand: | Abnova |
Reference: | H00008888-M01 |
Product name: | MCM3AP monoclonal antibody (M01), clone 1H3 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant MCM3AP. |
Clone: | 1H3 |
Isotype: | IgG2a Kappa |
Gene id: | 8888 |
Gene name: | MCM3AP |
Gene alias: | FLJ44336|FLJ45306|GANP|KIAA0572|MAP80 |
Gene description: | minichromosome maintenance complex component 3 associated protein |
Genbank accession: | BC013285 |
Immunogen: | MCM3AP (AAH13285, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | VRVARCCEDVCAHLVDLFLVEEIFQTAKETLQELQCFCKYLQRWREAVTARKKLRRQMRAFPAAPCCVDVSDRLRALAPSAECPIAEENLARGLLDLGHA |
Protein accession: | AAH13285 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunofluorescence of monoclonal antibody to MCM3AP on HeLa cell . [antibody concentration 10 ug/ml] |
Applications: | IF,S-ELISA,ELISA |
Shipping condition: | Dry Ice |