TAX1BP1 monoclonal antibody (M01), clone 2C3 View larger

TAX1BP1 monoclonal antibody (M01), clone 2C3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of TAX1BP1 monoclonal antibody (M01), clone 2C3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr

More info about TAX1BP1 monoclonal antibody (M01), clone 2C3

Brand: Abnova
Reference: H00008887-M01
Product name: TAX1BP1 monoclonal antibody (M01), clone 2C3
Product description: Mouse monoclonal antibody raised against a partial recombinant TAX1BP1.
Clone: 2C3
Isotype: IgG2a Kappa
Gene id: 8887
Gene name: TAX1BP1
Gene alias: CALCOCO3|T6BP|TXBP151
Gene description: Tax1 (human T-cell leukemia virus type I) binding protein 1
Genbank accession: NM_006024
Immunogen: TAX1BP1 (NP_006015, 690 a.a. ~ 789 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DSEDSKEDENVPTAPDPPSQHLRGHGTGFCFDSSFDVHKKCPLCELMFPPNYDQSKFEEHVESHWKVCPMCSEQFPPDYDQQVFERHVQTHFDQNVLNFD
Protein accession: NP_006015
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008887-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008887-M01-1-4-1.jpg
Application image note: TAX1BP1 monoclonal antibody (M01), clone 2C3 Western Blot analysis of TAX1BP1 expression in A-431 ( Cat # L015V1 ).
Applications: WB-Ce,S-ELISA,ELISA,WB-Re,WB-Tr
Shipping condition: Dry Ice

Reviews

Buy TAX1BP1 monoclonal antibody (M01), clone 2C3 now

Add to cart