FUBP1 monoclonal antibody (M02), clone 2H3 View larger

FUBP1 monoclonal antibody (M02), clone 2H3

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of FUBP1 monoclonal antibody (M02), clone 2H3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIF,ELISA,WB-Re

More info about FUBP1 monoclonal antibody (M02), clone 2H3

Brand: Abnova
Reference: H00008880-M02
Product name: FUBP1 monoclonal antibody (M02), clone 2H3
Product description: Mouse monoclonal antibody raised against a partial recombinant FUBP1.
Clone: 2H3
Isotype: IgG2a Kappa
Gene id: 8880
Gene name: FUBP1
Gene alias: FBP|FUBP
Gene description: far upstream element (FUSE) binding protein 1
Genbank accession: NM_003902
Immunogen: FUBP1 (NP_003893, 27 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI
Protein accession: NP_003893
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008880-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008880-M02-4-1-1-L.jpg
Application image note: Immunofluorescence of monoclonal antibody to FUBP1 on HeLa cell . [antibody concentration 10 ug/ml]
Applications: IF,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy FUBP1 monoclonal antibody (M02), clone 2H3 now

Add to cart