Brand: | Abnova |
Reference: | H00008876-M05 |
Product name: | VNN1 monoclonal antibody (M05), clone 2B10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant VNN1. |
Clone: | 2B10 |
Isotype: | IgG2a Kappa |
Gene id: | 8876 |
Gene name: | VNN1 |
Gene alias: | HDLCQ8|MGC116930|MGC116931|MGC116932|MGC116933|Tiff66 |
Gene description: | vanin 1 |
Genbank accession: | NM_004666 |
Immunogen: | VNN1 (NP_004657, 298 a.a. ~ 397 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KLLLSQLDSHPSHSAVVNWTSYASSIEALSSGNKEFKGTVFFDEFTFVKLTGVAGNYTVCQKDLCCHLSYKMSENIPNEVYALGAFDGLHTVEGRYYLQI |
Protein accession: | NP_004657 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged VNN1 is approximately 0.1ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,IP |
Shipping condition: | Dry Ice |