Brand: | Abnova |
Reference: | H00008874-A01 |
Product name: | ARHGEF7 polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant ARHGEF7. |
Gene id: | 8874 |
Gene name: | ARHGEF7 |
Gene alias: | BETA-PIX|COOL1|DKFZp686C12170|DKFZp761K1021|KIAA0142|KIAA0412|Nbla10314|P50|P50BP|P85|P85COOL1|P85SPR|PAK3|PIXB |
Gene description: | Rho guanine nucleotide exchange factor (GEF) 7 |
Genbank accession: | NM_145735 |
Immunogen: | ARHGEF7 (NP_663788, 102 a.a. ~ 190 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | SSLVTLNKVTADIGLGSDSVCARPSSHRIKSFDSLGSQSLHTRTSKLFQGQYRSLDMTDNSNNQLVVRAKFNFQQTNEDELSFSKGDVI |
Protein accession: | NP_663788 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008874-A01-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008874-A01-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.9 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |