Brand: | Abnova |
Reference: | H00008869-M04 |
Product name: | ST3GAL5 monoclonal antibody (M04), clone 8B4 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant ST3GAL5. |
Clone: | 8B4 |
Isotype: | IgG2a Kappa |
Gene id: | 8869 |
Gene name: | ST3GAL5 |
Gene alias: | SIAT9|SIATGM3S|ST3GalV |
Gene description: | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 |
Genbank accession: | NM_003896 |
Immunogen: | ST3GAL5 (NP_003887, 31 a.a. ~ 117 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | YTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQT |
Protein accession: | NP_003887 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: | ![qc_test-H00008869-M04-1.jpg](http://www.abnova.com/qc_test_image/qc_test-H00008869-M04-1.jpg) |
Quality control testing picture note: | Western Blot detection against Immunogen (35.31 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: | ![H00008869-M04-9-18-1.jpg](http://www.abnova.com/application_image/H00008869-M04-9-18-1.jpg) |
Application image note: | Detection limit for recombinant GST tagged ST3GAL5 is 3 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |