Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ST3GAL5 polyclonal antibody (A01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA,WB-Re |
More info about ST3GAL5 polyclonal antibody (A01)
| Brand: | Abnova |
| Reference: | H00008869-A01 |
| Product name: | ST3GAL5 polyclonal antibody (A01) |
| Product description: | Mouse polyclonal antibody raised against a partial recombinant ST3GAL5. |
| Gene id: | 8869 |
| Gene name: | ST3GAL5 |
| Gene alias: | SIAT9|SIATGM3S|ST3GalV |
| Gene description: | ST3 beta-galactoside alpha-2,3-sialyltransferase 5 |
| Genbank accession: | NM_003896 |
| Immunogen: | ST3GAL5 (NP_003887, 31 a.a. ~ 117 a.a) partial recombinant protein with GST tag. |
| Immunogen sequence/protein sequence: | YTTEECDMKKMHYVDPDHVKRAQKYAQQVLQKECRPKFAKTSMALLFEHRYSVDLLPFVQKAPKDSEAESKYDPPFGFRKFSSKVQT |
| Protein accession: | NP_003887 |
| Storage buffer: | 50 % glycerol |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (35.68 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Glycosylation-related gene expression is linked to differentiation status in glioblastomas undifferentiated cells.Cheray M, Petit D, Forestier L, Karayan-Tapon L, Maftah A, Jauberteau MO, Battu S, Gallet FP, Lalloue F. Cancer Letters (2011), doi: 10.1016/ j.canlet.2011.07.027 |