Brand: | Abnova |
Reference: | H00008867-M01A |
Product name: | SYNJ1 monoclonal antibody (M01A), clone 1A2 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant SYNJ1. |
Clone: | 1A2 |
Isotype: | IgG1 Kappa |
Gene id: | 8867 |
Gene name: | SYNJ1 |
Gene alias: | INPP5G |
Gene description: | synaptojanin 1 |
Genbank accession: | NM_003895 |
Immunogen: | SYNJ1 (NP_003886, 1474 a.a. ~ 1573 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | KISNPKGWVTFEEEEDFGVKGKSKSACSDLLGNQPSSFSGSNLTLNDDWNKGTNVSFCVLPSRRPPPPPVPLLPPGTSPPVDPFTTLASKASPTLDFTER |
Protein accession: | NP_003886 |
Storage buffer: | In ascites fluid |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | SYNJ1 monoclonal antibody (M01A), clone 1A2 Western Blot analysis of SYNJ1 expression in Hela S3 NE ( Cat # L013V3 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |