Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of PER2 monoclonal antibody (M01), clone 5C10
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,S-ELISA,ELISA,WB-Re |
More info about PER2 monoclonal antibody (M01), clone 5C10
| Brand: | Abnova |
| Reference: | H00008864-M01 |
| Product name: | PER2 monoclonal antibody (M01), clone 5C10 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant PER2. |
| Clone: | 5C10 |
| Isotype: | IgG2b Kappa |
| Gene id: | 8864 |
| Gene name: | PER2 |
| Gene alias: | FASPS|KIAA0347 |
| Gene description: | period homolog 2 (Drosophila) |
| Genbank accession: | NM_022817 |
| Immunogen: | PER2 (NP_073728, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MNGYAEFPPSPSNPTKEPVEPQPSQVPLQEDVDMSSGSSGHETNENCSTGRDSQGSDCDDSGKELGMLVEPPDARQSPDTFSLMMAKSEHNPSTSGCSSD |
| Protein accession: | NP_073728 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to PER2 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 1 ug/ml] |
| Applications: | IHC-P,IF,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |
| Publications: | Aberrant expression of Per1, Per2 and Per3 and their prognostic relevance in non-small cell lung cancer.Liu B, Xu K, Jiang Y, Li X Int J Clin Exp Pathol. 2014 Oct 15;7(11):7863-71. eCollection 2014. |