APLN monoclonal antibody (M02), clone 1A8-2A5 View larger

APLN monoclonal antibody (M02), clone 1A8-2A5

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of APLN monoclonal antibody (M02), clone 1A8-2A5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about APLN monoclonal antibody (M02), clone 1A8-2A5

Brand: Abnova
Reference: H00008862-M02
Product name: APLN monoclonal antibody (M02), clone 1A8-2A5
Product description: Mouse monoclonal antibody raised against a full length recombinant APLN.
Clone: 1A8-2A5
Isotype: IgG1 Kappa
Gene id: 8862
Gene name: APLN
Gene alias: XNPEP2
Gene description: apelin
Genbank accession: BC021104.1
Immunogen: APLN (AAH21104.1, 1 a.a. ~ 122 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD
Protein accession: AAH21104.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008862-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (39.16 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008862-M02-9-22-1.jpg
Application image note: Detection limit for recombinant GST tagged APLN is approximately 0.03ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy APLN monoclonal antibody (M02), clone 1A8-2A5 now

Add to cart