Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of APLN MaxPab mouse polyclonal antibody (B01)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Tr |
More info about APLN MaxPab mouse polyclonal antibody (B01)
| Brand: | Abnova |
| Reference: | H00008862-B01 |
| Product name: | APLN MaxPab mouse polyclonal antibody (B01) |
| Product description: | Mouse polyclonal antibody raised against a full-length human APLN protein. |
| Gene id: | 8862 |
| Gene name: | APLN |
| Gene alias: | XNPEP2 |
| Gene description: | apelin |
| Genbank accession: | BC021104 |
| Immunogen: | APLN (AAH21104.1, 1 a.a. ~ 122 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MSATWCSPEGQGMGQGPGREVGGNSAASGPASPIRDPCLSEAGLKGPPSAHPRRLCLLHRLVCFSGGLTSIQLSPRTCCSHQWAQLFSPACFPQWRAPGCSLDDSRSLTRIRPVHLPGPSLD |
| Protein accession: | AAH21104.1 |
| Storage buffer: | No additive |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Note: | For IHC and IF applications, antibody purification with Protein A will be needed prior to use. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Western Blot analysis of APLN expression in transfected 293T cell line (H00008862-T01) by APLN MaxPab polyclonal antibody. Lane1:APLN transfected lysate(13.53 KDa). Lane 2:Non-transfected lysate. |
| Applications: | WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Novel target genes responsive to the anti-growth activity of triptolide in endometrial and ovarian cancer cells.Li H, Takai N, Yuge A, Furukawa Y, Tsuno A, Tsukamoto Y, Kong S, Moriyama M, Narahara H. Cancer Lett. 2010 Jun 12. [Epub ahead of print] |