AKAP4 monoclonal antibody (M02), clone 4C10 View larger

AKAP4 monoclonal antibody (M02), clone 4C10

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of AKAP4 monoclonal antibody (M02), clone 4C10

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsIHC-P,S-ELISA,ELISA,WB-Re

More info about AKAP4 monoclonal antibody (M02), clone 4C10

Brand: Abnova
Reference: H00008852-M02
Product name: AKAP4 monoclonal antibody (M02), clone 4C10
Product description: Mouse monoclonal antibody raised against a partial recombinant AKAP4.
Clone: 4C10
Isotype: IgG2a Kappa
Gene id: 8852
Gene name: AKAP4
Gene alias: AKAP82|FSC1|HI|hAKAP82|p82
Gene description: A kinase (PRKA) anchor protein 4
Genbank accession: NM_003886
Immunogen: AKAP4 (NP_003877, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF
Protein accession: NP_003877
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008852-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.74 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008852-M02-3-12-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to AKAP4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml]
Applications: IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy AKAP4 monoclonal antibody (M02), clone 4C10 now

Add to cart