Brand: | Abnova |
Reference: | H00008852-M02 |
Product name: | AKAP4 monoclonal antibody (M02), clone 4C10 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant AKAP4. |
Clone: | 4C10 |
Isotype: | IgG2a Kappa |
Gene id: | 8852 |
Gene name: | AKAP4 |
Gene alias: | AKAP82|FSC1|HI|hAKAP82|p82 |
Gene description: | A kinase (PRKA) anchor protein 4 |
Genbank accession: | NM_003886 |
Immunogen: | AKAP4 (NP_003877, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MMAYSDTTMMSDDIDWLRSHRGVCKVDLYNPEGQQDQDRKVICFVDVSTLNVEDKDYKDAASSSSEGNLNLGSLEEKEIIVIKDTEKKDQSKTEGSVCLF |
Protein accession: | NP_003877 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoperoxidase of monoclonal antibody to AKAP4 on formalin-fixed paraffin-embedded human testis. [antibody concentration 1 ug/ml] |
Applications: | IHC-P,S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |