Brand: | Abnova |
Reference: | H00008850-Q01 |
Product name: | PCAF (Human) Recombinant Protein (Q01) |
Product description: | Human PCAF partial ORF ( AAH60823, 353 a.a. - 452 a.a.) recombinant protein with GST-tag at N-terminal. |
Gene id: | 8850 |
Gene name: | KAT2B |
Gene alias: | CAF|P|P/CAF|PCAF |
Gene description: | K(lysine) acetyltransferase 2B |
Genbank accession: | BC060823 |
Immunogen sequence/protein sequence: | LEEEVYSQNSPIWDQDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLEANPGEKRKMTDSHVLEEAKKPRVMGDIPME |
Protein accession: | AAH60823 |
Preparation method: | in vitro wheat germ expression system |
Storage buffer: | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Storage instruction: | Store at -80°C. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | 12.5% SDS-PAGE Stained with Coomassie Blue. |
Quality control testing picture: |  |
Note: | Best use within three months from the date of receipt of this protein. |
Tag: | GST |
Product type: | Proteins |
Host species: | Wheat Germ (in vitro) |
Antigen species / target species: | Human |
Applications: | AP,Array,ELISA,WB-Re |
Shipping condition: | Dry Ice |