PCAF monoclonal antibody (M14), clone 1C11 View larger

PCAF monoclonal antibody (M14), clone 1C11

H00008850-M14_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCAF monoclonal antibody (M14), clone 1C11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about PCAF monoclonal antibody (M14), clone 1C11

Brand: Abnova
Reference: H00008850-M14
Product name: PCAF monoclonal antibody (M14), clone 1C11
Product description: Mouse monoclonal antibody raised against a full-length recombinant PCAF.
Clone: 1C11
Isotype: IgG2a Kappa
Gene id: 8850
Gene name: KAT2B
Gene alias: CAF|P|P/CAF|PCAF
Gene description: K(lysine) acetyltransferase 2B
Genbank accession: NM_003884
Immunogen: PCAF (NP_003875, 367 a.a. ~ 432 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: QDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLE
Protein accession: NP_003875
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008850-M14-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (32.01 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy PCAF monoclonal antibody (M14), clone 1C11 now

Add to cart