Brand: | Abnova |
Reference: | H00008850-M12 |
Product name: | PCAF monoclonal antibody (M12), clone 1C9 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant PCAF. |
Clone: | 1C9 |
Isotype: | IgG2b Kappa |
Gene id: | 8850 |
Gene name: | KAT2B |
Gene alias: | CAF|P|P/CAF|PCAF |
Gene description: | K(lysine) acetyltransferase 2B |
Genbank accession: | NM_003884 |
Immunogen: | PCAF (NP_003875, 367 a.a. ~ 432 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | QDFLSASSRTSQLGIQTVINPPPVAGTISYNSTSSSLEQPNAGSSSPACKASSGLE |
Protein accession: | NP_003875 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (32.01 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA,WB-Re |
Shipping condition: | Dry Ice |