PCAF monoclonal antibody (M11), clone 4D11 View larger

PCAF monoclonal antibody (M11), clone 4D11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of PCAF monoclonal antibody (M11), clone 4D11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about PCAF monoclonal antibody (M11), clone 4D11

Brand: Abnova
Reference: H00008850-M11
Product name: PCAF monoclonal antibody (M11), clone 4D11
Product description: Mouse monoclonal antibody raised against a partial recombinant PCAF.
Clone: 4D11
Isotype: IgG2a Kappa
Gene id: 8850
Gene name: KAT2B
Gene alias: CAF|P|P/CAF|PCAF
Gene description: K(lysine) acetyltransferase 2B
Genbank accession: NM_003884
Immunogen: PCAF (NP_003875, 731 a.a. ~ 832 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: TLKSILQQVKSHQSAWPFMEPVKRTEAPGYYEVIRFPMDLKTMSERLKNRYYVSKKLFMADLQRVFTNCKEYNPPESEYYKCANILEKFFFSKIKEAGLIDK
Protein accession: NP_003875
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy PCAF monoclonal antibody (M11), clone 4D11 now

Add to cart