Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of TSC22D1 monoclonal antibody (M01), clone 1G7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
More info about TSC22D1 monoclonal antibody (M01), clone 1G7
| Brand: | Abnova |
| Reference: | H00008848-M01 |
| Product name: | TSC22D1 monoclonal antibody (M01), clone 1G7 |
| Product description: | Mouse monoclonal antibody raised against a full length recombinant TSC22D1. |
| Clone: | 1G7 |
| Isotype: | IgG1 kappa |
| Gene id: | 8848 |
| Gene name: | TSC22D1 |
| Gene alias: | DKFZp686O19206|MGC17597|RP11-269C23.2|TGFB1I4|TSC22 |
| Gene description: | TSC22 domain family, member 1 |
| Genbank accession: | BC000456 |
| Immunogen: | TSC22D1 (AAH00456, 1 a.a. ~ 144 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA |
| Protein accession: | AAH00456 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (41.58 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of monoclonal antibody to TSC22D1 on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IF,S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |