Cart 172 Product Products 19 024,18 € (empty)
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
1 x Phospho-Ly...259,07 € -
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
-
No products
To be determined Shipping
19 024,18 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 172 items in your cart. There is 1 item in your cart.
Total products (tax excl.) 19 024,18 €
Total shipping (tax excl.) To be determined
Total (tax excl.) 19 024,18 €
Data sheet of TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Rabbit |
| Applications | WB-Ce,WB-Tr |
More info about TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P)
| Brand: | Abnova |
| Reference: | H00008848-D01P |
| Product name: | TSC22D1 purified MaxPab rabbit polyclonal antibody (D01P) |
| Product description: | Rabbit polyclonal antibody raised against a full-length human TSC22D1 protein. |
| Gene id: | 8848 |
| Gene name: | TSC22D1 |
| Gene alias: | DKFZp686O19206|MGC17597|RP11-269C23.2|TGFB1I4|TSC22 |
| Gene description: | TSC22 domain family, member 1 |
| Genbank accession: | NM_006022.2 |
| Immunogen: | TSC22D1 (NP_006013.1, 1 a.a. ~ 144 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MKSQWCRPVAMDLGVYQLRHFSISFLSSLLGTENASVRLDNSSSGASVVAIDNKIEQAMDLVKSHLMYAVREEVEVLKEQIKELIEKNSQLEQENNLLKTLASPEQLAQFQAQLQTGSPPATTQPQGTTQPPAQPASQGSGPTA |
| Protein accession: | NP_006013.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Rabbit |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | TSC22D1 MaxPab rabbit polyclonal antibody. Western Blot analysis of TSC22D1 expression in Hela S3 NE. |
| Applications: | WB-Ce,WB-Tr |
| Shipping condition: | Dry Ice |