Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | IHC-P,IF,WB-Tr |
More info about ALKBH1 purified MaxPab mouse polyclonal antibody (B01P)
| Brand: | Abnova |
| Reference: | H00008846-B01P |
| Product name: | ALKBH1 purified MaxPab mouse polyclonal antibody (B01P) |
| Product description: | Mouse polyclonal antibody raised against a full-length human ALKBH1 protein. |
| Gene id: | 8846 |
| Gene name: | ALKBH1 |
| Gene alias: | ABH|ABH1|ALKBH|alkB|hABH |
| Gene description: | alkB, alkylation repair homolog 1 (E. coli) |
| Genbank accession: | BC025787.1 |
| Immunogen: | ALKBH1 (AAH25787.1, 1 a.a. ~ 389 a.a) full-length human protein. |
| Immunogen sequence/protein sequence: | MGKMAAAVGSVATLATEPGEDAFRKLFRFYRQSRPGTADLEGVIDFSAAHAARGKGPGAQKVIKSQLNVSSVSEQNAYRAGLQPVSKWQAYGLKGYPGFIFIPNPFLPGYQWHWVKQCLKLYSQKPNVCNLDKHMSKEETQDLWEQSKEFLRYKEATKRRPRSLLEKLRWVTVGYHYNWDSKKYSADHYTPFPSDLGFLSEQVAAACGFEDFRAEAGILNYYRLDSTLGIHVDRSELDHSKPLLSFSFGQSAIFLLGGLQRDEAPTAMFMHSGDIMIMSGFSRLLNHAVPRVLPNPEGEGLPHCLEAPLPAVLPRDSMVEPCSMEDWQVCASYLKTARVNMTVRQVLATDQNFPLEPIEDEKRDISTEGFCHLDDQNSEVKRARINPHS |
| Protein accession: | AAH25787.1 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody reactive against mammalian transfected lysate. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunofluorescence of purified MaxPab antibody to ALKBH on HeLa cell. [antibody concentration 10 ug/ml] |
| Applications: | IHC-P,IF,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | RNA cytosine methyltransferase Nsun3 regulates embryonic stem cell differentiation by promoting mitochondrial activity.Trixl L, Amort T, Wille A, Zinni M, Ebner S, Hechenberger C, Eichin F, Gabriel H, Schoberleitner I, Huang A, Piatti P, Nat R, Troppmair J, Lusser A. Cell Mol Life Sci. 2017 Nov 4. [Epub ahead of print] |