HDAC3 monoclonal antibody (M02), clone 3E11 View larger

HDAC3 monoclonal antibody (M02), clone 3E11

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HDAC3 monoclonal antibody (M02), clone 3E11

BrandAbnova
Product typePrimary antibodies
ReactivityHuman,Mouse,Rat
Host speciesMouse
ApplicationsWB-Ce,ELISA,WB-Re

More info about HDAC3 monoclonal antibody (M02), clone 3E11

Brand: Abnova
Reference: H00008841-M02
Product name: HDAC3 monoclonal antibody (M02), clone 3E11
Product description: Mouse monoclonal antibody raised against a partial recombinant HDAC3.
Clone: 3E11
Isotype: IgG2a Kappa
Gene id: 8841
Gene name: HDAC3
Gene alias: HD3|RPD3|RPD3-2
Gene description: histone deacetylase 3
Genbank accession: NM_003883
Immunogen: HDAC3 (NP_003874, 319 a.a. ~ 428 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: ISEELPYSEYFEYFAPDFTLHPDVSTRIENQNSRQYLDQIRQTIFENLKMLNHAPSVQIHDVPADLLTYDRTDEADAEERGPEENYSRPEAPNEFYDGDHDNDKESDVEI
Protein accession: NP_003874
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008841-M02-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human,Mouse,Rat
Application image: H00008841-M02-1-25-1.jpg
Application image note: HDAC3 monoclonal antibody (M02), clone 3E11 Western Blot analysis of HDAC3 expression in Hela S3 NE ( Cat # L013V3 ).
Applications: WB-Ce,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HDAC3 monoclonal antibody (M02), clone 3E11 now

Add to cart