Brand: | Abnova |
Reference: | H00008837-M03 |
Product name: | CFLAR monoclonal antibody (M03), clone 1G1 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant CFLAR. |
Clone: | 1G1 |
Isotype: | IgG2a Kappa |
Gene id: | 8837 |
Gene name: | CFLAR |
Gene alias: | CASH|CASP8AP1|CLARP|Casper|FLAME|FLAME-1|FLAME1|FLIP|I-FLICE|MRIT|c-FLIP|c-FLIPL|c-FLIPR|c-FLIPS |
Gene description: | CASP8 and FADD-like apoptosis regulator |
Genbank accession: | BC001602 |
Immunogen: | CFLAR (AAH01602, 178 a.a. ~ 277 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | AGTSYRNVLQAAIQKSLKDPSNNFRLHNGRSKEQRLKEQLGAQQEPVKKSIQESEAFLPQSIPEERYKMKSKPLGICLIIDCIGNETELLRDTFTSLGYE |
Protein accession: | AAH01602 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (36.63 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Immunoprecipitation of CFLAR transfected lysate using anti-CFLAR monoclonal antibody and Protein A Magnetic Bead (U0007), and immunoblotted with CFLAR MaxPab rabbit polyclonal antibody. |
Applications: | IF,ELISA,WB-Re,WB-Tr,IP |
Shipping condition: | Dry Ice |