SOCS2 (Human) Recombinant Protein (P01) View larger

SOCS2 (Human) Recombinant Protein (P01)

New product

279,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SOCS2 (Human) Recombinant Protein (P01)

BrandAbnova
Product typeProteins
Host speciesWheat Germ (in vitro)
ApplicationsAP,Array,ELISA,WB-Re

More info about SOCS2 (Human) Recombinant Protein (P01)

Brand: Abnova
Reference: H00008835-P01
Product name: SOCS2 (Human) Recombinant Protein (P01)
Product description: Human SOCS2 full-length ORF ( NP_003868.1, 1 a.a. - 198 a.a.) recombinant protein with GST-tag at N-terminal.
Gene id: 8835
Gene name: SOCS2
Gene alias: CIS2|Cish2|SOCS-2|SSI-2|SSI2|STATI2
Gene description: suppressor of cytokine signaling 2
Genbank accession: NM_003877.3
Immunogen sequence/protein sequence: MTLRCLEPSGNGGEGTRSQWGTAGSAEEPSPQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTSAGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
Protein accession: NP_003868.1
Preparation method: in vitro wheat germ expression system
Storage buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage instruction: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Quality control testing: 12.5% SDS-PAGE Stained with Coomassie Blue.
Quality control testing picture: qc_test-H00008835-P01-1.jpg
Note: Best use within three months from the date of receipt of this protein.
Tag: GST
Product type: Proteins
Host species: Wheat Germ (in vitro)
Antigen species / target species: Human
Applications: AP,Array,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: STAT5A-mediated SOCS2 expression regulates Jak2 and STAT3 activity following c-Src inhibition in head and neck squamous carcinoma.Sen B, Peng SH, Woods DM, Wistuba II, Bell D, El-Naggar AK, Lai SY, Johnson FM.
Clin Cancer Res. 2011 Nov 16.

Reviews

Buy SOCS2 (Human) Recombinant Protein (P01) now

Add to cart