Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of SOCS2 monoclonal antibody (M01A), clone 3E7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | ELISA |
More info about SOCS2 monoclonal antibody (M01A), clone 3E7
| Brand: | Abnova |
| Reference: | H00008835-M01A |
| Product name: | SOCS2 monoclonal antibody (M01A), clone 3E7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant SOCS2. |
| Clone: | 3E7 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8835 |
| Gene name: | SOCS2 |
| Gene alias: | CIS2|Cish2|SOCS-2|SSI-2|SSI2|STATI2 |
| Gene description: | suppressor of cytokine signaling 2 |
| Genbank accession: | BC010399 |
| Immunogen: | SOCS2 (AAH10399, 99 a.a. ~ 198 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | YQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVHLYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV |
| Protein accession: | AAH10399 |
| Storage buffer: | In ascites fluid |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Applications: | ELISA |
| Shipping condition: | Dry Ice |