Brand: | Abnova |
Reference: | H00008833-A01 |
Product name: | GMPS polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant GMPS. |
Gene id: | 8833 |
Gene name: | GMPS |
Gene alias: | - |
Gene description: | guanine monphosphate synthetase |
Genbank accession: | NM_003875 |
Immunogen: | GMPS (NP_003866, 108 a.a. ~ 215 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | QMMNKVFGGTVHKKSVREDGVFNISVDNTCSLFRGLQKEEVVLLTHGDSVDKVADGFKVVARSGNIVAGIANESKKLYGAQFHPEVGLTENGKVILKNFLYDIAGCSG |
Protein accession: | NP_003866 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (37.99 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | GMPS polyclonal antibody (A01), Lot # 051220JC01 Western Blot analysis of GMPS expression in HL-60 ( Cat # L014V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |