NRP2 monoclonal antibody (M01), clone 3B8 View larger

NRP2 monoclonal antibody (M01), clone 3B8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of NRP2 monoclonal antibody (M01), clone 3B8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about NRP2 monoclonal antibody (M01), clone 3B8

Brand: Abnova
Reference: H00008828-M01
Product name: NRP2 monoclonal antibody (M01), clone 3B8
Product description: Mouse monoclonal antibody raised against a partial recombinant NRP2.
Clone: 3B8
Isotype: IgG1 Kappa
Gene id: 8828
Gene name: NRP2
Gene alias: MGC126574|NP2|NPN2|PRO2714|VEGF165R2
Gene description: neuropilin 2
Genbank accession: NM_201279
Immunogen: NRP2 (NP_958436, 621 a.a. ~ 715 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: EEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYDHAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVC
Protein accession: NP_958436
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008828-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.19 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008828-M01-9-20-1.jpg
Application image note: Detection limit for recombinant GST tagged NRP2 is approximately 0.3ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy NRP2 monoclonal antibody (M01), clone 3B8 now

Add to cart