Brand: | Abnova |
Reference: | H00008821-M03 |
Product name: | INPP4B monoclonal antibody (M03), clone 3F2 |
Product description: | Mouse monoclonal antibody raised against a full-length recombinant INPP4B. |
Clone: | 3F2 |
Isotype: | IgG2b Kappa |
Gene id: | 8821 |
Gene name: | INPP4B |
Gene alias: | MGC132014 |
Gene description: | inositol polyphosphate-4-phosphatase, type II, 105kDa |
Genbank accession: | BC005273 |
Immunogen: | INPP4B (AAH05273, 1 a.a. ~ 53 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | MEIKEEGASEEGQHFLPTAQANDPGDCQFTSIQKTPNEPQLEFILDLNQELRD |
Protein accession: | AAH05273 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (31.57 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | Detection limit for recombinant GST tagged INPP4B is 1 ng/ml as a capture antibody. |
Applications: | S-ELISA,ELISA,WB-Re |
Shipping condition: | Dry Ice |