HESX1 monoclonal antibody (M01), clone 2C4 View larger

HESX1 monoclonal antibody (M01), clone 2C4

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of HESX1 monoclonal antibody (M01), clone 2C4

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about HESX1 monoclonal antibody (M01), clone 2C4

Brand: Abnova
Reference: H00008820-M01
Product name: HESX1 monoclonal antibody (M01), clone 2C4
Product description: Mouse monoclonal antibody raised against a partial recombinant HESX1.
Clone: 2C4
Isotype: IgG2b Kappa
Gene id: 8820
Gene name: HESX1
Gene alias: ANF|MGC138294|RPX
Gene description: HESX homeobox 1
Genbank accession: NM_003865
Immunogen: HESX1 (NP_003856.1, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MSPSLQEGAQLGENKPSTCSFSIERILGLDQKKDCVPLMKPHRPWADTCSSSGKDGNLCLHVPNPPSGISFPSVVDHPMPEERASKYENYFSASERLSLKRELSWYRGRR
Protein accession: NP_003856.1
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008820-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (37.84 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008820-M01-9-19-1.jpg
Application image note: Detection limit for recombinant GST tagged HESX1 is approximately 1ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy HESX1 monoclonal antibody (M01), clone 2C4 now

Add to cart