SAP30 monoclonal antibody (M03), clone 1D3 View larger

SAP30 monoclonal antibody (M03), clone 1D3

H00008819-M03_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SAP30 monoclonal antibody (M03), clone 1D3

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about SAP30 monoclonal antibody (M03), clone 1D3

Brand: Abnova
Reference: H00008819-M03
Product name: SAP30 monoclonal antibody (M03), clone 1D3
Product description: Mouse monoclonal antibody raised against a partial recombinant SAP30.
Clone: 1D3
Isotype: IgG2a Kappa
Gene id: 8819
Gene name: SAP30
Gene alias: -
Gene description: Sin3A-associated protein, 30kDa
Genbank accession: NM_003864
Immunogen: SAP30 (NP_003855, 131 a.a. ~ 219 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SDDDGGDSPVQDIDTPEVDLYQLQVNTLRRYKRHFKLPTRPGLNKAQLVEIVGCHFRSIPVNEKDTLTYFIYSVKNDKNKSDLKVDSGV
Protein accession: NP_003855
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008819-M03-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SAP30 monoclonal antibody (M03), clone 1D3 now

Add to cart