BANF1 monoclonal antibody (M01), clone 3F10-4G12 View larger

BANF1 monoclonal antibody (M01), clone 3F10-4G12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of BANF1 monoclonal antibody (M01), clone 3F10-4G12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsWB-Ce,IHC-P,S-ELISA,ELISA,WB-Re

More info about BANF1 monoclonal antibody (M01), clone 3F10-4G12

Brand: Abnova
Reference: H00008815-M01
Product name: BANF1 monoclonal antibody (M01), clone 3F10-4G12
Product description: Mouse monoclonal antibody raised against a full length recombinant BANF1.
Clone: 3F10-4G12
Isotype: IgG2a Kappa
Gene id: 8815
Gene name: BANF1
Gene alias: BAF|BCRP1|D14S1460|MGC111161
Gene description: barrier to autointegration factor 1
Genbank accession: BC005942
Immunogen: BANF1 (AAH05942, 1 a.a. ~ 89 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: MTTSQKHRDFVAEPMGEKPVGSLAGIGEVLGKKLEERGFDKAYVVLGQFLVLKKDEDLFREWLKDTCGANAKQSRDCFGCLREWCDAFL
Protein accession: AAH05942
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008815-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (35.53 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008815-M01-3-35-1-L.jpg
Application image note: Immunoperoxidase of monoclonal antibody to BANF1 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
Applications: WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice
Publications: Dephosphorylation of barrier-to-autointegration-factor by protein phosphatase 4 and its role in cell mitosis.Zhuang X, Semenova E, Maric D, Craigie R
J Biol Chem. 2013 Nov 21.

Reviews

Buy BANF1 monoclonal antibody (M01), clone 3F10-4G12 now

Add to cart