Brand: | Abnova |
Reference: | H00008809-M01 |
Product name: | IL18R1 monoclonal antibody (M01), clone 3C8 |
Product description: | Mouse monoclonal antibody raised against a partial recombinant IL18R1. |
Clone: | 3C8 |
Isotype: | IgG2b Kappa |
Gene id: | 8809 |
Gene name: | IL18R1 |
Gene alias: | CD218a|CDw218a|IL-1Rrp|IL18RA|IL1RRP |
Gene description: | interleukin 18 receptor 1 |
Genbank accession: | NM_003855 |
Immunogen: | IL18R1 (NP_003846, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
Immunogen sequence/protein sequence: | CTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFT |
Protein accession: | NP_003846 |
Storage buffer: | In 1x PBS, pH 7.4 |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Applications: | ELISA |
Shipping condition: | Dry Ice |