IL18R1 monoclonal antibody (M01), clone 3C8 View larger

IL18R1 monoclonal antibody (M01), clone 3C8

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL18R1 monoclonal antibody (M01), clone 3C8

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA

More info about IL18R1 monoclonal antibody (M01), clone 3C8

Brand: Abnova
Reference: H00008809-M01
Product name: IL18R1 monoclonal antibody (M01), clone 3C8
Product description: Mouse monoclonal antibody raised against a partial recombinant IL18R1.
Clone: 3C8
Isotype: IgG2b Kappa
Gene id: 8809
Gene name: IL18R1
Gene alias: CD218a|CDw218a|IL-1Rrp|IL18RA|IL1RRP
Gene description: interleukin 18 receptor 1
Genbank accession: NM_003855
Immunogen: IL18R1 (NP_003846, 22 a.a. ~ 121 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: CTSRPHITVVEGEPFYLKHCSCSLAHEIETTTKSWYKSSGSQEHVELNPRSSSRIALHDCVLEFWPVELNDTGSYFFQMKNYTQKWKLNVIRRNKHSCFT
Protein accession: NP_003846
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA
Shipping condition: Dry Ice

Reviews

Buy IL18R1 monoclonal antibody (M01), clone 3C8 now

Add to cart