IL1RL2 monoclonal antibody (M01), clone 5G5 View larger

IL1RL2 monoclonal antibody (M01), clone 5G5

H00008808-M01_100ug

New product

395,00 € tax excl.

100 ug

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of IL1RL2 monoclonal antibody (M01), clone 5G5

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsELISA,WB-Re

More info about IL1RL2 monoclonal antibody (M01), clone 5G5

Brand: Abnova
Reference: H00008808-M01
Product name: IL1RL2 monoclonal antibody (M01), clone 5G5
Product description: Mouse monoclonal antibody raised against a partial recombinant IL1RL2.
Clone: 5G5
Isotype: IgG1 Kappa
Gene id: 8808
Gene name: IL1RL2
Gene alias: IL1R-rp2|IL1RRP2
Gene description: interleukin 1 receptor-like 2
Genbank accession: NM_003854
Immunogen: IL1RL2 (NP_003845, 20 a.a. ~ 118 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: DGCKDIFMKNEILSASQPFAFNCTFPPITSGEVSVTWYKNSSKIPVSKIIQSRIHQDETWILFLPMEWGDSGVYQCVIKGRDSCHRIHVNLTVFEKHWC
Protein accession: NP_003845
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008808-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.63 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Applications: ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy IL1RL2 monoclonal antibody (M01), clone 5G5 now

Add to cart