Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of IL18RAP monoclonal antibody (M04), clone 4G4
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | S-ELISA,ELISA,WB-Re,WB-Tr |
More info about IL18RAP monoclonal antibody (M04), clone 4G4
| Brand: | Abnova |
| Reference: | H00008807-M04 |
| Product name: | IL18RAP monoclonal antibody (M04), clone 4G4 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant IL18RAP. |
| Clone: | 4G4 |
| Isotype: | IgG2a Kappa |
| Gene id: | 8807 |
| Gene name: | IL18RAP |
| Gene alias: | ACPL|CD218b|CDw218b|IL18RB|MGC120589|MGC120590 |
| Gene description: | interleukin 18 receptor accessory protein |
| Genbank accession: | NM_003853 |
| Immunogen: | IL18RAP (NP_003844, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK |
| Protein accession: | NP_003844 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (37.84 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Detection limit for recombinant GST tagged IL18RAP is 0.3 ng/ml as a capture antibody. |
| Applications: | S-ELISA,ELISA,WB-Re,WB-Tr |
| Shipping condition: | Dry Ice |
| Publications: | Association study of the IL18RAP locus in three European populations with coeliac disease.Koskinen LL, Einarsdottir E, Dukes E, Heap GA, Dubois P, Korponay-Szabo IR, Kaukinen K, Kurppa K, Ziberna F, Vatta S, Not T, Ventura A, Sistonen P, Adany R, Pocsai Z, Szeles G, Maki M, Kere J, Wijmenga C, van Heel DA, Saavalainen P. Hum Mol Genet. 2009 Mar 15;18(6):1148-55. Epub 2008 Dec 22. |