Brand: | Abnova |
Reference: | H00008807-A01 |
Product name: | IL18RAP polyclonal antibody (A01) |
Product description: | Mouse polyclonal antibody raised against a partial recombinant IL18RAP. |
Gene id: | 8807 |
Gene name: | IL18RAP |
Gene alias: | ACPL|CD218b|CDw218b|IL18RB|MGC120589|MGC120590 |
Gene description: | interleukin 18 receptor accessory protein |
Genbank accession: | NM_003853 |
Immunogen: | IL18RAP (NP_003844, 20 a.a. ~ 129 a.a) partial recombinant protein with GST tag. |
Immunogen sequence/protein sequence: | FNISGCSTKKLLWTYSTRSEEEFVLFCDLPEPQKSHFCHRNRLSPKQVPEHLPFMGSNDLSDVQWYQQPSNGDPLEDIRKSYPHIIQDKCTLHFLTPGVNNSGSYICRPK |
Protein accession: | NP_003844 |
Storage buffer: | 50 % glycerol |
Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
Quality control testing: | Antibody Reactive Against Recombinant Protein. |
Quality control testing picture: |  |
Quality control testing picture note: | Western Blot detection against Immunogen (38.21 KDa) . |
Product type: | Primary antibodies |
Host species: | Mouse |
Antigen species / target species: | Human |
Reactivity: | Human |
Application image: |  |
Application image note: | IL18RAP polyclonal antibody (A01), Lot # 060104JC01 Western Blot analysis of IL18RAP expression in Y-79 ( Cat # L042V1 ). |
Applications: | WB-Ce,ELISA,WB-Re |
Shipping condition: | Dry Ice |