Cart 0 Product Products (empty)
No products
To be determined Shipping
0,00 € Total
Prices are tax excluded
Product successfully added to your shopping cart
Quantity
Total
There are 0 items in your cart. There is 1 item in your cart.
Total products (tax excl.)
Total shipping (tax excl.) To be determined
Total (tax excl.)
Data sheet of CREG1 monoclonal antibody (M01), clone 1B7
| Brand | Abnova |
| Product type | Primary antibodies |
| Reactivity | Human |
| Host species | Mouse |
| Applications | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
More info about CREG1 monoclonal antibody (M01), clone 1B7
| Brand: | Abnova |
| Reference: | H00008804-M01 |
| Product name: | CREG1 monoclonal antibody (M01), clone 1B7 |
| Product description: | Mouse monoclonal antibody raised against a partial recombinant CREG1. |
| Clone: | 1B7 |
| Isotype: | IgG1 Kappa |
| Gene id: | 8804 |
| Gene name: | CREG1 |
| Gene alias: | CREG |
| Gene description: | cellular repressor of E1A-stimulated genes 1 |
| Genbank accession: | NM_003851 |
| Immunogen: | CREG1 (NP_003842, 121 a.a. ~ 220 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. |
| Immunogen sequence/protein sequence: | PYATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWVLDYFGGPKIVTPEEYYNVTVQ |
| Protein accession: | NP_003842 |
| Storage buffer: | In 1x PBS, pH 7.4 |
| Storage instruction: | Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing. |
| Quality control testing: | Antibody Reactive Against Recombinant Protein. |
| Quality control testing picture: |  |
| Quality control testing picture note: | Western Blot detection against Immunogen (36.74 KDa) . |
| Product type: | Primary antibodies |
| Host species: | Mouse |
| Antigen species / target species: | Human |
| Reactivity: | Human |
| Application image: |  |
| Application image note: | Immunoperoxidase of monoclonal antibody to CREG1 on formalin-fixed paraffin-embedded human adrenal gland. [antibody concentration 3 ug/ml] |
| Applications: | WB-Ce,IHC-P,S-ELISA,ELISA,WB-Re |
| Shipping condition: | Dry Ice |