SCEL monoclonal antibody (M01), clone 4B12 View larger

SCEL monoclonal antibody (M01), clone 4B12

New product

395,00 € tax excl.

Customer ratings and reviews

Nobody has posted a review yet
in this language

Data sheet of SCEL monoclonal antibody (M01), clone 4B12

BrandAbnova
Product typePrimary antibodies
ReactivityHuman
Host speciesMouse
ApplicationsS-ELISA,ELISA,WB-Re

More info about SCEL monoclonal antibody (M01), clone 4B12

Brand: Abnova
Reference: H00008796-M01
Product name: SCEL monoclonal antibody (M01), clone 4B12
Product description: Mouse monoclonal antibody raised against a partial recombinant SCEL.
Clone: 4B12
Isotype: IgG2b Kappa
Gene id: 8796
Gene name: SCEL
Gene alias: FLJ21667|MGC22531
Gene description: sciellin
Genbank accession: NM_003843
Immunogen: SCEL (NP_003834.2, 2 a.a. ~ 97 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen sequence/protein sequence: SNVTLRKMSPTGNEMKSTTQGTTRKQQDFHEVNKRRTFLQDNSWIKKRPEEEKDENYGRVVLNRHNSHDALDRKVNERDVPKATISRYSSDDTLDR
Protein accession: NP_003834.2
Storage buffer: In 1x PBS, pH 7.4
Storage instruction: Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Quality control testing: Antibody Reactive Against Recombinant Protein.
Quality control testing picture: qc_test-H00008796-M01-1.jpg
Quality control testing picture note: Western Blot detection against Immunogen (36.3 KDa) .
Product type: Primary antibodies
Host species: Mouse
Antigen species / target species: Human
Reactivity: Human
Application image: H00008796-M01-9-21-1.jpg
Application image note: Detection limit for recombinant GST tagged SCEL is 0.1 ng/ml as a capture antibody.
Applications: S-ELISA,ELISA,WB-Re
Shipping condition: Dry Ice

Reviews

Buy SCEL monoclonal antibody (M01), clone 4B12 now

Add to cart